PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf38556g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 503aa    MW: 56541.4 Da    PI: 7.3216
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf38556g00006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.81e-093183502254
                               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               ++yp+++++  LAk++gL+ +qV++WF N R +
  Niben101Scf38556g00006.1 318 HPYPTETDKVMLAKQTGLSRNQVSNWFINARVR 350
                               89*****************************88 PP

2BELL105.92.6e-34178247372
                      BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                e+ kkk++L+ +l+eV++rYkqy++qlq+v+ sFeavaglg+a+p+++lAlk++S+hF cLk+ai++q+
  Niben101Scf38556g00006.1 178 DEHGKKKSRLILMLDEVYQRYKQYHQQLQMVVTSFEAVAGLGNAAPFANLALKTMSKHFNCLKNAITDQL 247
                               5899***************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-43122245IPR006563POX domain
PfamPF075262.6E-34127244IPR006563POX domain
PROSITE profilePS5007112.082291354IPR001356Homeobox domain
CDDcd000861.08E-11294355No hitNo description
SMARTSM003896.3E-10294358IPR001356Homeobox domain
SuperFamilySSF466892.27E-17296360IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-28297358IPR009057Homeodomain-like
PfamPF059206.4E-19311350IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MAEEFEPYHV PQQSRRDKLR VLVDDNLQLQ NYAPYYDPSI ILSDLPTFQE INGTTFLYTP  60
QNLRFLDQSI RTSSEIMVHN SSNNNNSNGQ GLSLSLSSLR HNSTTNHELL SKSSCVPLGP  120
FTGYSLILKR SRFSKPAQLL LEELCDVGRE RLAADDSTLM GPLHENIVVD RQYCSNGDEH  180
GKKKSRLILM LDEVYQRYKQ YHQQLQMVVT SFEAVAGLGN AAPFANLALK TMSKHFNCLK  240
NAITDQLQFT NESCHGQINS EKDPIPRVGK GLYCHRPDQI HNNAGFADRT QPVWRPQRGL  300
PERAVTVLRA WLFDHFLHPY PTETDKVMLA KQTGLSRNQV SNWFINARVR LWKPMVEEIH  360
MLETKEVHNK SYQREGQNDN NNSIEHFPTS NSHAACETPS TSAPRLQDIP SKRTRNDIPT  420
GNADSISLSY GNLSTGTGGV SLTLGLHQNT GIGLSEPFPI NAARRFGIDA NSDRFMVGGG  480
FEEQNGQFGR NIVGGQFLHD FAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-16300358563Homeobox protein Meis2
3k2a_B6e-16300358563Homeobox protein Meis2
4xrs_A5e-16300357158Homeobox protein Meis1
4xrs_B5e-16300357158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606015.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM81e-110BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLM1C8Y50.0M1C8Y5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000623530.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-99TALE family protein